DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and CG11865

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster


Alignment Length:214 Identity:77/214 - (35%)
Similarity:111/214 - (51%) Gaps:15/214 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 YFQGDMDVDYARNGQLSET---RRWPNATVPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPAD 99
            ||:|:::      |::.::   ..|...|:.|..:..|.:..:..|:..|..|...:|::|...:
  Fly    38 YFEGNLE------GRVVKSWSEYYWKGRTLVYSYAGGFSSLDIASIESAMAEISSKTCVKFRRTE 96

  Fly   100 EDEENYLFVLPSTSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNR 164
            ...|..:.:....|||.|.|||. |.....|..||   ||....||||||||.|||.|....|.|
  Fly    97 YKREPQVVIQKEGSGCWSYVGYL-GRADQTLNLGS---GCMSNRTIQHELLHALGFFHTHSDPQR 157

  Fly   165 DEFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFSINGEATIVALNPEGQEQ 229
            |::|:|..:||..|||.||.:...:.|.::...|||.||:||...|||.||::|||.|  :...:
  Fly   158 DKYVRIQTDNIRSGHEHNFQRLRANGVTNYGFGYDYDSIMHYGPFAFSKNGQSTIVPL--KSHAK 220

  Fly   230 MGQRLMMSDTDVKRLNTMY 248
            :||...||..||:.|..||
  Fly   221 IGQATQMSPKDVQTLKRMY 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 73/192 (38%)
ZnMc_astacin_like 61..248 CDD:239807 70/186 (38%)
CG11865NP_609759.1 Astacin 56..239 CDD:279708 71/188 (38%)
ZnMc_astacin_like 58..239 CDD:239807 70/186 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444816
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D109979at50557
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.