DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and Semp1

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster


Alignment Length:256 Identity:106/256 - (41%)
Similarity:148/256 - (57%) Gaps:18/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RVWFQLFLL-GTLCSGIFPAPFNTHYDETDPELTAGYFQGDMDVD--YARNGQLSETRRWPNATV 64
            ::|..:||. .|:.|.:|          .||||.||::|||:...  ..|||.:::...|||.||
  Fly     4 QIWGVIFLFTPTVFSELF----------KDPELLAGFYQGDIKAHPIRTRNGIVNQIYHWPNRTV 58

  Fly    65 PYRISEE-FDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTS-GCSS-KVGYQPGER 126
            ||.|.:: |...|...|...:..||.:||:.|.||.|.:.....|:.|.. ||:: .:||:...:
  Fly    59 PYMIEDDAFADSHYREILRAISIIEENSCVIFKPATEMDFPMALVITSKGLGCNTVHLGYRNKTQ 123

  Fly   127 TVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEV 191
            .|.|:...|..|||::|:|.|||||.|||.||..|.|||::|.|..:||:..:..|||..:....
  Fly   124 VVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTA 188

  Fly   192 -GDFDQPYDYGSILHYSSLAFSINGEATIVALNPEGQEQMGQRLMMSDTDVKRLNTMYKCP 251
             .|||:.|||.|::||...|||.||:.|||.|. ||.|.||||..||:.|:::||.||:||
  Fly   189 WHDFDEGYDYESVMHYVPRAFSRNGQPTIVPLR-EGAENMGQRFYMSEKDIRKLNKMYRCP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 86/197 (44%)
ZnMc_astacin_like 61..248 CDD:239807 82/190 (43%)
Semp1NP_609756.1 Astacin 53..249 CDD:279708 88/197 (45%)
ZnMc_astacin_like 55..245 CDD:239807 82/190 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444820
Domainoid 1 1.000 145 1.000 Domainoid score I4540
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D109979at50557
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.