DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and CG15255

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster


Alignment Length:263 Identity:111/263 - (42%)
Similarity:151/263 - (57%) Gaps:23/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FQLFLLGTLCSGIFPAPFNTHYDETDPELTAGYFQGDM------------DVDYARNGQLSETRR 58
            :.|.|...|.|| .|.|...:    |||...|:.:|||            ....||||.::..:|
  Fly     8 YVLLLQVVLNSG-KPLPAGVY----DPEEAGGFVEGDMMLTEEQQRNLEQGAPKARNGLINTEKR 67

  Fly    59 WPNATVPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVGYQ- 122
            ||...|.||||::||..|.:.|:.|:..:|..:|:||..|.::::.||.|...:.||.:.|||| 
  Fly    68 WPGNVVVYRISDDFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQG 132

  Fly   123 -PGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKY 186
             |.|..:::.|  |..|||:.|||.||.:|.|||:|||.|..||:|:.::.|||..|.|.||.||
  Fly   133 APQEMNLEIYP--LGEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKY 195

  Fly   187 EEDEVGDFDQPYDYGSILHYSSLAFSINGEATIVALNPEGQEQMGQRLMMSDTDVKRLNTMYKCP 251
            .:..|.||:..|||.|.|||...|||||||.|||.|  :....:|||:.:|..|:.::|.|||||
  Fly   196 ADTVVTDFEVGYDYDSCLHYRPGAFSINGEDTIVPL--DSSAVIGQRVGLSSKDIDKINIMYKCP 258

  Fly   252 IQL 254
            |.|
  Fly   259 ILL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 89/195 (46%)
ZnMc_astacin_like 61..248 CDD:239807 83/188 (44%)
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 89/195 (46%)
ZnMc_astacin_like 70..255 CDD:239807 83/188 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444893
Domainoid 1 1.000 145 1.000 Domainoid score I4540
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D109979at50557
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.