DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and mep1bb

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_009294699.1 Gene:mep1bb / 327586 ZFINID:ZDB-GENE-030131-5797 Length:774 Species:Danio rerio


Alignment Length:214 Identity:79/214 - (36%)
Similarity:115/214 - (53%) Gaps:9/214 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FQGDM--DVDYARNGQLSETRRWPNATVPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADED 101
            |:||:  |....||..:.|..|||. |:||...::.:......|....:.....:||.:.|. ..
Zfish    61 FEGDILYDETLGRNSIIGEEYRWPK-TIPYYFEDDLEINAKGVILKAFEQYRLKTCIDYKPW-TG 123

  Fly   102 EENYLFVLPSTSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDE 166
            ||||:.|... :||.|.|    |.|.|..:..|:.:||.::.||:||.||.|||.|:|...:||:
Zfish   124 EENYISVFKG-NGCFSSV----GNRRVGRQTLSIGSGCDRIATIEHEFLHALGFWHEQSRSDRDD 183

  Fly   167 FVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFSINGEATIVALNPEGQEQMG 231
            :|.|:.:.|:||.|.||.||.:......:.||||.|::|||..||....|.||:...|.....:|
Zfish   184 YVSIMWDRITEGKEHNFNKYNDSSSSALNVPYDYSSMMHYSQKAFQSGSEPTIITRIPAFSSVIG 248

  Fly   232 QRLMMSDTDVKRLNTMYKC 250
            ||:..||:|:.:||.:|.|
Zfish   249 QRMEFSDSDLLKLNRLYNC 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 72/194 (37%)
ZnMc_astacin_like 61..248 CDD:239807 67/186 (36%)
mep1bbXP_009294699.1 ZnMc 39..267 CDD:294052 78/212 (37%)
Astacin 81..269 CDD:279708 72/194 (37%)
MAM 277..441 CDD:279023
MAM 277..440 CDD:99706
MATH 440..608 CDD:295307
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.