DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and Adgrg6

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_218313.7 Gene:Adgrg6 / 308376 RGDID:1308551 Length:1248 Species:Rattus norvegicus


Alignment Length:233 Identity:55/233 - (23%)
Similarity:76/233 - (32%) Gaps:46/233 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WFQ----LFLLGTLCSGIFPAPF----NTHYDETDPELTAGYFQGD-MDVDYARNGQLSETRRWP 60
            |.|    |..|..||...||.|.    |.....::|   :|.|... ...||......|.|.|.|
  Rat    13 WRQKSSTLLFLFALCVACFPLPVWGCGNCRLVLSNP---SGTFTSPCYPNDYPNTQSCSWTLRAP 74

  Fly    61 NATVPYRISEEFD---APHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCS--SKVG 120
            ...:......:||   ||:..|..|.:              |..|....|...:..|.|  |.| 
  Rat    75 TGYIIQITFNDFDIEEAPNCIYDSLSL--------------DNGESQTKFCGATAKGLSFNSSV- 124

  Fly   121 YQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQ--CSPNRDEFVKIVEENISEGHEKNF 183
               .|..|..   |.|....|.|.....:...:...:|:  .....|.:...|.::||....|.|
  Rat   125 ---NEMHVSF---SSDFSIQKKGFNASYIRVAVSLRNQKVILPQTLDAYQVSVAKSISIPELKAF 183

  Fly   184 -VKYEEDEVGDFDQ-----PYDYGSILHYSSLAFSING 215
             :.:|..:||:.|.     .|...|:....||..:.||
  Rat   184 TLCFEASKVGNEDDDWTAFSYSDKSLTQLLSLEKANNG 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 38/172 (22%)
ZnMc_astacin_like 61..248 CDD:239807 36/168 (21%)
Adgrg6XP_218313.7 CUB 38..146 CDD:238001 29/131 (22%)
LamG 178..337 CDD:304605 12/44 (27%)
GPS 799..844 CDD:280071
7tm_4 861..1108 CDD:304433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.