DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and Astl

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001099974.1 Gene:Astl / 296129 RGDID:1562279 Length:436 Species:Rattus norvegicus


Alignment Length:270 Identity:78/270 - (28%)
Similarity:116/270 - (42%) Gaps:52/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CSGI----FPAPFNTHYDETDPELTAGYFQGDMDVDYARNGQLSE-------------------- 55
            |||:    .|..|.       ||  ......|.|:.....|.:||                    
  Rat    30 CSGVCSTSVPEGFT-------PE--GSRVSQDKDIPAINQGLISEETPESSFLVEGDIIRPSPFR 85

  Fly    56 -----TRRWPNAT-----VPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLP 110
                 ..:||...     :|:.:|.::|.|..:.|.......|..:||||| |...:.:::.:||
  Rat    86 LLSVTNNKWPKGVDGIVEIPFLLSSKYDEPSRQVIMEAFAEFERFTCIRFV-AYRGQRDFVSILP 149

  Fly   111 STSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENI 175
             .:||.|.||...|.:.|.|.|..|..|   .|.:.|||:|.|||.|:....:||.::::....|
  Rat   150 -MAGCFSGVGRSGGMQVVSLAPTCLQKG---RGIVLHELMHVLGFWHEHSRADRDRYIRVNWNEI 210

  Fly   176 SEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFSINGEATIVALNPEGQEQMGQRLMMSDTD 240
            ..|.|.||:|...   .:...||||.|::||...|||..|:.||:.| ......:|||..:|.:|
  Rat   211 LPGFEINFIKSRN---SNMLAPYDYSSVMHYGRFAFSWRGQPTIIPL-WTSSVHIGQRWNLSTSD 271

  Fly   241 VKRLNTMYKC 250
            :.|:..:|.|
  Rat   272 ITRVCRLYSC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 66/199 (33%)
ZnMc_astacin_like 61..248 CDD:239807 62/191 (32%)
AstlNP_001099974.1 Astacin 92..283 CDD:279708 66/199 (33%)
ZnMc 99..281 CDD:294052 63/190 (33%)
ImpA_N <305..420 CDD:303075
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.