DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and Mep1b

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_037315.1 Gene:Mep1b / 25727 RGDID:3081 Length:704 Species:Rattus norvegicus


Alignment Length:262 Identity:88/262 - (33%)
Similarity:135/262 - (51%) Gaps:21/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WFQLFLLGTLCSGIFPAP--FNTHYD--------ETDPELTAGYFQGDMDVDYA-RNGQLSETRR 58
            ||.:|....|.||: |||  |....|        :.:.:|....|:||:.::.: ||..:.:..|
  Rat     8 WFLVFATFLLVSGL-PAPEKFVKDIDGGIDQDIFDINEDLGLDLFEGDIKLEASGRNSIIGDNYR 71

  Fly    59 WPNATVPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVG-YQ 122
            ||: |:||.:.:..:......|....:.....:||.|.|. ..||||:.|... |||.|.|| ..
  Rat    72 WPH-TIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPW-SGEENYISVFKG-SGCWSSVGNIH 133

  Fly   123 PGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYE 187
            .|::.:     |:.|.|.::.|:|||.||.|||.|:|...:||:::.||.:.|..|.|.||..|.
  Rat   134 AGKQEL-----SIGTNCDRIATVQHEFLHALGFWHEQSRADRDDYITIVWDRILSGKEHNFNIYN 193

  Fly   188 EDEVGDFDQPYDYGSILHYSSLAFSINGEATIVALNPEGQEQMGQRLMMSDTDVKRLNTMYKCPI 252
            :......:.||||.|::|||..||....|:||:....:.::.:|||:..||.|:.:||.:|.|..
  Rat   194 DSVSDSLNVPYDYTSVMHYSKTAFQNGTESTIITKISDFEDVIGQRMDFSDYDLLKLNQLYSCTS 258

  Fly   253 QL 254
            .|
  Rat   259 SL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 69/194 (36%)
ZnMc_astacin_like 61..248 CDD:239807 65/187 (35%)
Mep1bNP_037315.1 ZnMc 30..256 CDD:294052 76/233 (33%)
Astacin 70..258 CDD:279708 70/195 (36%)
MAM 266..430 CDD:279023
MAM 266..428 CDD:99706
MATH 428..586 CDD:295307
EGF_CA 609..647 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.