DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and Mep1a

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_037275.1 Gene:Mep1a / 25684 RGDID:3080 Length:748 Species:Rattus norvegicus


Alignment Length:242 Identity:80/242 - (33%)
Similarity:116/242 - (47%) Gaps:23/242 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NTHYDETDPEL------------TAG--YFQGDMDVDYARNGQLSETRRWPNATVPYRISEEFDA 74
            :|.:|..|.::            .||  .||||:.:...||.....:.|| ...:||.:::..|.
  Rat    27 STGHDHDDVDVGEQQKDISEINSAAGLNLFQGDILLPRTRNALRDPSSRW-KPPIPYILADNLDL 90

  Fly    75 PHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVGYQPGERTVKLKPGSLDTGC 139
            .....|....:.....||:.|.|. |.|.:|: :....|||.|.||.|...:.:     |:..||
  Rat    91 NAKGAILNAFEMFRLKSCVDFKPY-EGESSYI-IFQQFSGCWSMVGDQHVGQNI-----SIGEGC 148

  Fly   140 FKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSIL 204
            .....|:||:||.|||.|:|...:||::|.|....|...:|.||..|::..:.|.:.||||.|::
  Rat   149 DYKAIIEHEILHALGFFHEQSRTDRDDYVNIWWNEIMTDYEHNFNTYDDKTITDLNTPYDYESLM 213

  Fly   205 HYSSLAFSINGE-ATIVALNPEGQEQMGQRLMMSDTDVKRLNTMYKC 250
            ||...:|:.|.. .||....||....:||||..|.||:.|||.||.|
  Rat   214 HYGPFSFNKNETIPTITTKIPEFNAIIGQRLDFSATDLTRLNRMYNC 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 69/195 (35%)
ZnMc_astacin_like 61..248 CDD:239807 64/187 (34%)
Mep1aNP_037275.1 ZnMc 32..260 CDD:294052 77/235 (33%)
Astacin 75..261 CDD:279708 69/194 (36%)
MAM 270..433 CDD:279023
MAM 270..432 CDD:99706
MATH 432..596 CDD:295307
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 641..668
EGF 676..710 CDD:278437
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.