DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and Tll2

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_036034.1 Gene:Tll2 / 24087 MGIID:1346044 Length:1012 Species:Mus musculus


Alignment Length:209 Identity:72/209 - (34%)
Similarity:104/209 - (49%) Gaps:13/209 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RNGQLSETRR-WPNATVPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPST 112
            |....|.|.| ||...:||.|...|........|..|:..|..:|:.||.. .|||:::.....|
Mouse   145 RRATTSRTERIWPGGVIPYVIGGNFTGTQRAIFKQAMRHWEKHTCVTFVER-TDEESFIVFSYRT 208

  Fly   113 SGCSSKVGYQPGERTVKLKPGSLDTG--CFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENI 175
            .||.|.||.:.|      .|.::..|  |.|.|.:.|||.|.:||.|:...|:||:.|.|:.|||
Mouse   209 CGCCSYVGRRGG------GPQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENI 267

  Fly   176 SEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFS--INGEATIVALNPEG-QEQMGQRLMMS 237
            ..|.|.||:|.|..||....:.||:.||:||:...||  :..:..:...:..| :..:|||:.:|
Mouse   268 QPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRRDDNGVRPTIGQRVRLS 332

  Fly   238 DTDVKRLNTMYKCP 251
            ..|:.:...:||||
Mouse   333 QGDIAQARKLYKCP 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 67/199 (34%)
ZnMc_astacin_like 61..248 CDD:239807 62/191 (32%)
Tll2NP_036034.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..135
ZnMc_BMP1_TLD 147..346 CDD:239808 69/205 (34%)
Astacin 154..347 CDD:279708 69/200 (35%)
CUB 348..457 CDD:278839
CUB 461..570 CDD:278839
FXa_inhibition 581..613 CDD:291342
CUB 617..726 CDD:278839
FXa_inhibition 733..768 CDD:291342
CUB 773..882 CDD:278839
CUB 886..999 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3579
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.