DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and Tnfaip6

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_033424.1 Gene:Tnfaip6 / 21930 MGIID:1195266 Length:275 Species:Mus musculus


Alignment Length:107 Identity:24/107 - (22%)
Similarity:45/107 - (42%) Gaps:10/107 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 KVGY---QPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGH 179
            :|||   :||......|.|.:|.| .:|...:....:....|.::|.....:..:|.:   |.|.
Mouse    91 RVGYPIVKPGPNCGFGKTGIIDYG-IRLNRSERWDAYCYNPHAKECGGVFTDPKRIFK---SPGF 151

  Fly   180 EKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFSINGEATIVA 221
            ..   :|::::|..:.....||..:|.|.|.|.:..:...:|
Mouse   152 PN---EYDDNQVCYWHIRLKYGQRIHLSFLDFDLEHDPGCLA 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 24/107 (22%)
ZnMc_astacin_like 61..248 CDD:239807 24/107 (22%)
Tnfaip6NP_033424.1 Link_domain_TSG_6_like 36..128 CDD:239592 10/37 (27%)
CUB 135..244 CDD:278839 13/62 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..275
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.