DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and Astl

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001277932.1 Gene:Astl / 215095 MGIID:3046414 Length:435 Species:Mus musculus


Alignment Length:290 Identity:84/290 - (28%)
Similarity:123/290 - (42%) Gaps:62/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WF--QLFLLG--------TLCSGI----FPAPFNTHYDETDPELTAGYFQGDMDVDYARNGQLSE 55
            |.  .|.|||        :.|||:    .|..|.       || .:..|| |.|:.....|.:||
Mouse    10 WILTMLSLLGLSMGAPSASRCSGVCSTSVPEGFT-------PE-GSPVFQ-DKDIPAINQGLISE 65

  Fly    56 -------------------------TRRWPNAT-----VPYRISEEFDAPHVEYIKLGMQFIEYS 90
                                     ..:||...     :|:.:|.::|......|.......|..
Mouse    66 ETPESSFLVEGDIIRPSPFRLLSVTNNKWPKGVGGFVEIPFLLSRKYDELSRRVIMDAFAEFERF 130

  Fly    91 SCIRFVPADEDEENYLFVLPSTSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGF 155
            :||||| |...:.:::.:|| .:||.|.||...|.:.|.|.|..|..|   .|.:.|||:|.|||
Mouse   131 TCIRFV-AYHGQRDFVSILP-MAGCFSGVGRSGGMQVVSLAPTCLRKG---RGIVLHELMHVLGF 190

  Fly   156 HHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFSINGEATIV 220
            .|:....:||.::::....|..|.|.||:|....   :...||||.|::||...|||..|:.||:
Mouse   191 WHEHSRADRDRYIQVNWNEILPGFEINFIKSRST---NMLVPYDYSSVMHYGRFAFSWRGQPTII 252

  Fly   221 ALNPEGQEQMGQRLMMSDTDVKRLNTMYKC 250
            .| ......:|||..:|.:|:.|:..:|.|
Mouse   253 PL-WTSSVHIGQRWNLSTSDITRVCRLYNC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 65/199 (33%)
ZnMc_astacin_like 61..248 CDD:239807 61/191 (32%)
AstlNP_001277932.1 Astacin 92..282 CDD:279708 65/199 (33%)
ZnMc 100..281 CDD:294052 62/189 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.