DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and nas-30

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_490795.5 Gene:nas-30 / 190803 WormBaseID:WBGene00003548 Length:741 Species:Caenorhabditis elegans


Alignment Length:263 Identity:80/263 - (30%)
Similarity:126/263 - (47%) Gaps:38/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AP-FNTHYDETD----PELTAGYFQGDM------------DVDYARNGQLSETR--------RWP 60
            || ...|.|.|:    ..||...|:.||            ....|||....:.|        || 
 Worm   270 APMLQAHRDGTELGANRALTNKLFESDMVLTVKQMKAIVLAAQEARNPHGRKKRKVITGSVYRW- 333

  Fly    61 NATVPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVGYQPGE 125
            .:.:|:|. :..||...:.|:.|:...|..:|:|:......::..:|.  ..|||.|.||...|.
 Worm   334 KSVIPFRF-KGGDAKWKKLIREGLGLWEKETCVRWSENGPGKDYVIFF--RGSGCYSSVGRTGGS 395

  Fly   126 RTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDE 190
            :.:     |:..||...|.:.||:.|:|||.|:|..|:||:::.:.::.|.:|.:.||.|...:|
 Worm   396 QLI-----SIGYGCEDKGIVAHEVGHSLGFWHEQSRPDRDDYIHLRKDWIIKGTDGNFEKRSWEE 455

  Fly   191 VGDFDQPYDYGSILHYSSLAFSIN-GEATIVALNPEGQEQMGQRLMMSDTDVKRLNTMY---KCP 251
            :.|...|||.||::||.|.||:.: .:.||...:...|..:|||..:|..|||::|.:|   .||
 Worm   456 IEDMGVPYDVGSVMHYGSNAFTKDWDQITIETKDSRYQGTIGQRQKLSFIDVKQVNRLYCNSVCP 520

  Fly   252 IQL 254
            :.|
 Worm   521 VAL 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 64/205 (31%)
ZnMc_astacin_like 61..248 CDD:239807 60/187 (32%)
nas-30NP_490795.5 ZnMc_astacin_like 336..514 CDD:239807 60/185 (32%)
CUB 564..648 CDD:412131
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.