DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and Y19D10A.6

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_503652.3 Gene:Y19D10A.6 / 189484 WormBaseID:WBGene00021221 Length:272 Species:Caenorhabditis elegans


Alignment Length:208 Identity:54/208 - (25%)
Similarity:86/208 - (41%) Gaps:45/208 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 WPNATVPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLP--STSGCSSKVGY 121
            ||||.|||.|:..:.:.....|...|:..:..:|:||.|....:::||.:..  :...|.|.:|.
 Worm    60 WPNAEVPYDIATHYTSTEKSIILSAMEAFKNVTCVRFRPRAATDKHYLQINKYFNVERCFSYIGR 124

  Fly   122 QPGERTVKLKPGS------LDTGCFK---LGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISE 177
            |..........|:      ||..|.:   .|.:.|||:|.|||:|:....:||..:      :..
 Worm   125 QSSRTLFGTPEGNVETRMRLDPACLRGNGRGIVMHELMHILGFYHEHQRDDRDRRI------VGS 183

  Fly   178 GHEKNFVKYEEDE---VGDFDQPYDYGSILHYS--SLAFSINGEATIVALNPEGQEQMGQRLMMS 237
            ....||..|...:   :|    .||..||:||:  :|.:.                   :|...|
 Worm   184 AVHYNFKIYRRAKTLYMG----AYDANSIMHYNFQNLPWQ-------------------RRDHFS 225

  Fly   238 DTDVKRLNTMYKC 250
            .:|:..:||.|||
 Worm   226 TSDIININTFYKC 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 54/208 (26%)
ZnMc_astacin_like 61..248 CDD:239807 49/202 (24%)
Y19D10A.6NP_503652.3 Astacin 58..240 CDD:279708 54/208 (26%)
ZnMc 62..236 CDD:294052 49/202 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.