DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and nas-5

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_492616.1 Gene:nas-5 / 188819 WormBaseID:WBGene00003524 Length:360 Species:Caenorhabditis elegans


Alignment Length:210 Identity:60/210 - (28%)
Similarity:98/210 - (46%) Gaps:9/210 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RNGQLSET-RRWP-------NATVPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENY 105
            ||..||.: .||.       |..:||.||..:|....:.||..|:.|..::|||.:|.....:..
 Worm    60 RNALLSNSPLRWSKMQDLDGNYLIPYVISGNYDTVERDTIKTAMEKIANNTCIRLIPRTNQPDYA 124

  Fly   106 LFVLPSTSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKI 170
            ........||.:.:|..||:..|.|:... |..|.:..|:.|||.|.:|..|:....:||.|:.:
 Worm   125 EINNKKGQGCYASIGRFPGKNVVMLESND-DQSCIQEDTVIHELFHVIGLWHEHMRADRDAFINV 188

  Fly   171 VEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFSINGEATIVALNPEGQEQMGQRLM 235
            :.:||.......|.|....:...:..||||.|::||...||:..|:.:::..:.:.|:.:|....
 Worm   189 LYKNIEPAQYPQFEKLSSRDATTYSVPYDYNSVMHYDENAFAKPGKISMMTKDSKFQKVIGHPKD 253

  Fly   236 MSDTDVKRLNTMYKC 250
            .|..|.|::..:|.|
 Worm   254 ASSNDYKKVCAIYHC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 56/201 (28%)
ZnMc_astacin_like 61..248 CDD:239807 52/186 (28%)
nas-5NP_492616.1 ZnMc_astacin_like 80..266 CDD:239807 52/186 (28%)
Astacin 83..269 CDD:279708 53/187 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.