DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and nas-27

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_493926.2 Gene:nas-27 / 188809 WormBaseID:WBGene00003545 Length:428 Species:Caenorhabditis elegans


Alignment Length:224 Identity:68/224 - (30%)
Similarity:105/224 - (46%) Gaps:25/224 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FQGDMDV--DYARNGQLSETRRWPNATVPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADED 101
            :|||:.|  ..||...:.:..:.....:||.....|.:...:.:...|||....:|:.|      
 Worm    44 YQGDIAVVKSRARRAVIRQKHKKWKLPMPYSFDRNFPSRSRQRVLEAMQFWSEKTCVTF------ 102

  Fly   102 EENYLFVLPSTS-----GCSSKVGYQPGERTVKLKPGSLDTGC----FKLGTIQHELLHTLGFHH 157
            .|| .:|.|..|     ||.|.||.||..|...|   ||:..|    |   .:.||:.|||||:|
 Worm   103 HEN-RYVYPHVSIFEGNGCWSFVGKQPSLREQSL---SLERSCTDHTF---VVAHEIAHTLGFYH 160

  Fly   158 QQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFSIN-GEATIVA 221
            :....:||:|:.|...|::......|.|..|.::...:..|:|||::|||...|::| ....|.|
 Worm   161 EHARGDRDQFISIDYSNVNPNLTFAFAKESEKQLDHQEAAYEYGSVMHYSVDQFAVNTNRPVIYA 225

  Fly   222 LNPEGQEQMGQRLMMSDTDVKRLNTMYKC 250
            .:.:..:.||.|:..:..||.|:|.:|.|
 Worm   226 RDQKFAQAMGNRMRATFQDVSRMNVLYNC 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 62/204 (30%)
ZnMc_astacin_like 61..248 CDD:239807 60/196 (31%)
nas-27NP_493926.2 Astacin 65..254 CDD:279708 61/201 (30%)
ZnMc_astacin_like 70..252 CDD:239807 60/194 (31%)
CUB 334..410 CDD:294042
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.