DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and nas-17

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_505892.1 Gene:nas-17 / 186923 WormBaseID:WBGene00003536 Length:448 Species:Caenorhabditis elegans


Alignment Length:265 Identity:76/265 - (28%)
Similarity:118/265 - (44%) Gaps:33/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FQLFLL-GTLCSGIFPA-----PFNTHYDETDPEL-TAGYFQGDMDVDYAR----NGQLSETRR- 58
            |.:||. .||...:|.|     ......||.|... ..|...||:.:..|:    ||....::| 
 Worm    18 FDMFLRPSTLLLTLFLALVAGSAIRKDVDEFDSNKGKDGIVDGDIMLTEAQLRILNGTAKRSKRQ 82

  Fly    59 -------WPNATVPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCS 116
                   ||:|.|.|....||.:...|.:...|..|..::|::|..::.......|.  :|.||:
 Worm    83 ITKIWKKWPDAKVFYYYENEFTSLKRELMSYAMAHISSNTCVKFQESNSATNRIRFT--NTGGCA 145

  Fly   117 SKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEK 181
            |.:|...||:|:     ....||...||..||::|:||..|.....:||.|:.:..:::.|....
 Worm   146 SYIGMNGGEQTL-----WFGDGCLIFGTAVHEIMHSLGLFHTHSRFDRDNFLSVSYKDVPENMVG 205

  Fly   182 NFVKYEEDEVGDFDQ-PYDYGSILHYSSLAFSINGEATIVALNPEGQEQMGQRLMMSDTDVKRLN 245
            |..|  |.|...::. |::|||.:.|....|   ||.|:|:.|.:.|:.||.| .:|..|:..:|
 Worm   206 NLEK--ETEQTTYNAVPFEYGSTMLYRYNTF---GEGTLVSKNEDYQKTMGLR-RVSFYDLVNIN 264

  Fly   246 TMYKC 250
            ..|.|
 Worm   265 VRYSC 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 60/203 (30%)
ZnMc_astacin_like 61..248 CDD:239807 55/187 (29%)
nas-17NP_505892.1 Astacin 88..271 CDD:279708 59/195 (30%)
ZnMc_astacin_like 92..267 CDD:239807 55/187 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.