Sequence 1: | NP_609760.1 | Gene: | CG7631 / 34919 | FlyBaseID: | FBgn0028945 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_505889.2 | Gene: | nas-16 / 186922 | WormBaseID: | WBGene00003535 | Length: | 337 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 54/201 - (26%) |
---|---|---|---|
Similarity: | 84/201 - (41%) | Gaps: | 63/201 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 80 IKLGMQFIEYSSCIRFVPADEDEEN------YLFVLPSTSGCSSKVG--------YQPGERTVKL 130
Fly 131 KPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFD 195
Fly 196 ----------QPYDYGSILHYSSLAFSINGEATIVALNPEGQEQMGQRLMMSDTDVKRLNTMY-- 248
Fly 249 KCPIQL 254 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7631 | NP_609760.1 | Astacin | 57..251 | CDD:279708 | 51/196 (26%) |
ZnMc_astacin_like | 61..248 | CDD:239807 | 49/191 (26%) | ||
nas-16 | NP_505889.2 | ZnMc | 4..156 | CDD:294052 | 48/188 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D681837at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10127 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.920 |