DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and nas-16

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_505889.2 Gene:nas-16 / 186922 WormBaseID:WBGene00003535 Length:337 Species:Caenorhabditis elegans


Alignment Length:201 Identity:54/201 - (26%)
Similarity:84/201 - (41%) Gaps:63/201 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 IKLGMQFIEYSSCIRFVPADEDEEN------YLFVLPSTSGCSSKVG--------YQPGERTVKL 130
            :|..|.||...:|:.|      |||      ..||  .::.|:|.||        |.|       
 Worm     1 MKFAMNFISSQTCVTF------EENCTISTRIKFV--DSTFCASYVGMINSVQEIYFP------- 50

  Fly   131 KPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFD 195
                  ..|.:.|:..|||:|.||..|.....:||.|:.:           |..|.:||: .:|:
 Worm    51 ------DWCMRFGSAVHELMHALGVLHTHARFDRDNFLNV-----------NLNKDDEDD-SNFE 97

  Fly   196 ----------QPYDYGSILHYSSLAFSINGEATIVALNPEGQEQMGQRLMMSDTDVKRLNTMY-- 248
                      .||:|||.|||::   .::|..:::....|....:|.| .::..|:..:||.|  
 Worm    98 IVSPPFSINVVPYEYGSTLHYTA---DVSGTNSLLPKQMEYYRTLGNR-RVTFYDMLTINTAYNC 158

  Fly   249 KCPIQL 254
            |||.:|
 Worm   159 KCPSEL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 51/196 (26%)
ZnMc_astacin_like 61..248 CDD:239807 49/191 (26%)
nas-16NP_505889.2 ZnMc 4..156 CDD:294052 48/188 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.