DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and nas-31

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001023994.1 Gene:nas-31 / 186493 WormBaseID:WBGene00003549 Length:611 Species:Caenorhabditis elegans


Alignment Length:239 Identity:71/239 - (29%)
Similarity:104/239 - (43%) Gaps:39/239 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FQGDMDV------------DYARNGQLSETRR-------WPNAT----VPYRISEEFDAPHVEYI 80
            :||||.:            |.......|..||       :|:.|    |.|..........|:..
 Worm   127 YQGDMVLTDDQIATILEARDETTVSTASRARRQAYRDRYYPSTTWGSSVYYYYDRTATPKIVKAF 191

  Fly    81 KLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTI 145
            :..:.|.:..:||..:.: ....|.:.|... .||.|.||...|.:.:     ||.|||.:.||.
 Worm   192 EQAVAFWQNVTCINIMQS-STAINRIRVFKG-QGCYSYVGRISGVQDL-----SLGTGCEEFGTA 249

  Fly   146 QHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLA 210
            .|||.|.|||.|.|...:||.::.|...||...:.:.|.|...:...::..|||||||:.|.:.:
 Worm   250 AHELGHALGFFHTQSRYDRDNYISINYANIDPSYVEQFDKETSNTNFNYGMPYDYGSIMQYGATS 314

  Fly   211 FSINGEATIVALNPEGQEQMGQRLMMSD----TDVKRLNTMYKC 250
            .|.|.:||::|.:.|.|:.||     ||    .|:..:|..|||
 Worm   315 ASSNDKATMIARDTEYQDTMG-----SDFVGFYDISMMNEHYKC 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 65/209 (31%)
ZnMc_astacin_like 61..248 CDD:239807 59/194 (30%)
nas-31NP_001023994.1 Astacin 169..355 CDD:279708 62/197 (31%)
ZnMc_astacin_like 175..351 CDD:239807 58/187 (31%)
ShKT 532..564 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.