DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and nas-28

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_498342.3 Gene:nas-28 / 185658 WormBaseID:WBGene00003546 Length:497 Species:Caenorhabditis elegans


Alignment Length:250 Identity:73/250 - (29%)
Similarity:118/250 - (47%) Gaps:32/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YDETDPELTAGYFQGDMDVDYAR---------NGQLSETRR--------WPNATVP--YRISEEF 72
            ::|.:.::....|:.|:.::..:         ||.....|:        | :.:||  |:...:.
 Worm    81 FEELNQDINEYTFESDIMLNEKQAKHIATAIENGNYRSKRQAIVDTTNFW-SVSVPIFYQFDTKL 144

  Fly    73 DAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVGYQ---PGERTVKLKPGS 134
            .|.::..::..:||...:||:.| ..|.:.:|.|| |.|..||.|.||.|   |.:..      |
 Worm   145 SATNIANVRKAIQFWNDNSCLSF-KEDNNAKNRLF-LSSAGGCWSYVGKQVDMPYQMV------S 201

  Fly   135 LDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYD 199
            :...|...||..|||:|.:||.|||...:||.:|.:...||......||.|...|:....:.|||
 Worm   202 VGPNCDTFGTATHELMHAIGFWHQQSRADRDNYVYVDFSNIIPSQAYNFQKMAVDQAQLLNLPYD 266

  Fly   200 YGSILHYSSLAFSI-NGEATIVALNPEGQEQMGQRLMMSDTDVKRLNTMYKCPIQ 253
            |||::.|...||:: :.:.||:|.....|..||||...:.:|:..:|.:|.|..|
 Worm   267 YGSVMQYYPYAFAVDSSKYTILAKENGFQNSMGQREAPAFSDIIGVNKLYNCTSQ 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 66/207 (32%)
ZnMc_astacin_like 61..248 CDD:239807 63/192 (33%)
nas-28NP_498342.3 Astacin 135..320 CDD:279708 64/192 (33%)
ZnMc_astacin_like 135..316 CDD:239807 62/188 (33%)
CUB 393..480 CDD:214483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.