DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and nas-13

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_510549.3 Gene:nas-13 / 185492 WormBaseID:WBGene00003532 Length:450 Species:Caenorhabditis elegans


Alignment Length:236 Identity:77/236 - (32%)
Similarity:118/236 - (50%) Gaps:17/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SGIFPAPFNTHYDETDPELTAGYFQGDMDVDYARNGQLSETRRWPNATVPYRISEEFDAPHVEYI 80
            ||:.....||.:.::.   ..|.|      ...||.......:|..|.:||.||.::.:.....|
 Worm    85 SGLNSRSINTFFGDSP---LFGIF------GVQRNAVRQTYLKWEQARIPYTISSQYSSYSRSKI 140

  Fly    81 KLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTI 145
            ...::.....:||.|.|....:.:|:.::|. .||.|.||...|:     :|.||..||.:.|.|
 Worm   141 AEAIEEYRKKTCIDFSPKSAGDLDYIHIVPD-DGCYSLVGRIGGK-----QPVSLGDGCIQKGII 199

  Fly   146 QHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLA 210
            .|||:|.:||.|:|...:|||:|||...|:..|.:..|.||..:.:......|||||::||:..|
 Worm   200 IHELMHAVGFFHEQSRADRDEYVKINWSNVEAGLQDQFDKYSLNMIDHLGTKYDYGSVMHYAPTA 264

  Fly   211 FSINGEATIVALNPEGQEQMGQRLMMSDTDVKRLNTMYKCP 251
            ||.||:.||..:  |...::|||...|:.|:.::|.:|.||
 Worm   265 FSKNGKPTIEPI--EKNVEIGQRAGFSENDIYKINMLYNCP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 67/193 (35%)
ZnMc_astacin_like 61..248 CDD:239807 65/186 (35%)
nas-13NP_510549.3 Astacin 118..304 CDD:279708 69/194 (36%)
ZnMc_astacin_like 122..300 CDD:239807 65/185 (35%)
ShK 367..404 CDD:279838
ShK 414..450 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.