| Sequence 1: | NP_609760.1 | Gene: | CG7631 / 34919 | FlyBaseID: | FBgn0028945 | Length: | 254 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_502533.2 | Gene: | nas-14 / 184247 | WormBaseID: | WBGene00003533 | Length: | 503 | Species: | Caenorhabditis elegans |
| Alignment Length: | 309 | Identity: | 99/309 - (32%) |
|---|---|---|---|
| Similarity: | 142/309 - (45%) | Gaps: | 77/309 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 9 FLLG-TLCSGIFPAPFNTH-------YDE----------------------TDPEL----TAGYF 39
Fly 40 QGD---------------------MDVD--------YARNGQLSETRRWPNATVPYRISEEFDAP 75
Fly 76 HVEYIKLGMQFIEY--SSCIRFVPADEDEENYLFVLPSTS-GCSSKVGYQPGERTVKLKPGSLDT 137
Fly 138 GCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGS 202
Fly 203 ILHYSSLAFSINGEATIVALNPEGQE-QMGQRLMMSDTDVKRLNTMYKC 250 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7631 | NP_609760.1 | Astacin | 57..251 | CDD:279708 | 78/198 (39%) |
| ZnMc_astacin_like | 61..248 | CDD:239807 | 74/190 (39%) | ||
| nas-14 | NP_502533.2 | Astacin | 123..313 | CDD:279708 | 78/198 (39%) |
| ZnMc_astacin_like | 128..309 | CDD:239807 | 74/189 (39%) | ||
| ShKT | 380..414 | CDD:214586 | |||
| ShK | 468..503 | CDD:279838 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D472790at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000240 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.820 | |||||