DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and nas-4

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001254938.1 Gene:nas-4 / 182259 WormBaseID:WBGene00003523 Length:365 Species:Caenorhabditis elegans


Alignment Length:259 Identity:89/259 - (34%)
Similarity:139/259 - (53%) Gaps:28/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TLCSGIFPAPFNTHYD--------ETDPELTAGYFQGDMDVDYAR-----NGQLSET------RR 58
            ||....|.:..:..||        :.||.: ..|.:||:.::..:     |.:|...      ||
 Worm    40 TLNDADFHSDLHQRYDLQTLGIKVKDDPTI-GNYSEGDILLESPKKFVEENNKLGRNAIKQIYRR 103

  Fly    59 WPNATVPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDE-ENYLFVLPSTSGCSSKVGYQ 122
            |||..:||.:|.::.:.....|...|......:|::||..|..: .:||::.|. .||.|.||..
 Worm   104 WPNNEIPYTLSSQYGSYARSVIANAMNEYHTKTCVKFVARDPSKHHDYLWIHPD-EGCYSLVGKT 167

  Fly   123 PGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYE 187
            .|:     :|.|||:||.::|||.|||:|.:||.|:|...:||.::.:|.:|:..|.:..|.||.
 Worm   168 GGK-----QPVSLDSGCIQVGTIVHELMHAVGFFHEQSRQDRDSYIDVVWQNVMNGADDQFEKYN 227

  Fly   188 EDEVGDFDQPYDYGSILHYSSLAFSINGEATIVALNPEGQEQMGQRLMMSDTDVKRLNTMYKCP 251
            .:.:...|:||||.||:||...|||.:|:.|:|. ...|.|:||||:..||.||:::|.:|.||
 Worm   228 LNVISHLDEPYDYASIMHYGPYAFSGSGKKTLVP-KKSGSERMGQRVKFSDIDVRKINKLYNCP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 75/194 (39%)
ZnMc_astacin_like 61..248 CDD:239807 70/187 (37%)
nas-4NP_001254938.1 Astacin 102..290 CDD:279708 75/194 (39%)
ZnMc_astacin_like 106..287 CDD:239807 70/187 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.