DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and nas-6

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001040902.1 Gene:nas-6 / 181796 WormBaseID:WBGene00003525 Length:344 Species:Caenorhabditis elegans


Alignment Length:244 Identity:75/244 - (30%)
Similarity:119/244 - (48%) Gaps:36/244 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 THYDETDPELTAGYFQGDMD-VD--------------YARNGQLSETRRWPNATVPYRISEEFDA 74
            ||::..:    :|.||||:| ||              ..:|.||:    |....:||.:...|..
 Worm    40 THHEWQN----SGKFQGDIDGVDPNLLKLPEGPVLFNALKNKQLT----WEGGVIPYEMDTAFSP 96

  Fly    75 PHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVGYQPGERTVKLKPGSLDTGC 139
            ..::.::........::|||| ...|.:.:||.::.. .||.|:||...|::.:     ||..||
 Worm    97 NEIKILEKAFDSYRRTTCIRF-EKREGQTDYLNIVKG-YGCYSQVGRTGGKQEI-----SLGRGC 154

  Fly   140 FKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYE---EDEVGDFDQPYDYG 201
            |....|.|||:|::||.|:....:||:.:||..:||..|.:..|.|..   :|..|   :.|||.
 Worm   155 FFHEIIVHELMHSVGFWHEHSRADRDDHIKINWDNILPGMKSQFDKISAVLQDLQG---ENYDYK 216

  Fly   202 SILHYSSLAFSINGEATIVALNPEGQEQMGQRLMMSDTDVKRLNTMYKC 250
            ||:||.|.|||.||..||..:.....:.:|..:.:|..|:.::|.:|.|
 Worm   217 SIMHYDSTAFSRNGRNTIETVENGFTQVIGTAMDLSPLDIVKINKLYSC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 62/197 (31%)
ZnMc_astacin_like 61..248 CDD:239807 59/189 (31%)
nas-6NP_001040902.1 Astacin 80..265 CDD:279708 61/198 (31%)
ZnMc_astacin_like 83..263 CDD:239807 59/189 (31%)
ShK 299..334 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_112325
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.