Sequence 1: | NP_609760.1 | Gene: | CG7631 / 34919 | FlyBaseID: | FBgn0028945 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510440.1 | Gene: | hch-1 / 181564 | WormBaseID: | WBGene00001828 | Length: | 605 | Species: | Caenorhabditis elegans |
Alignment Length: | 257 | Identity: | 79/257 - (30%) |
---|---|---|---|
Similarity: | 116/257 - (45%) | Gaps: | 47/257 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 ETDPELTAGYFQGDM---------------DVDYARNGQLSE---------------TRRWPNAT 63
Fly 64 VPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVP----ADEDEENYL-FVLPSTSGCSSKVGYQP 123
Fly 124 GERTVKLKPG--SLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKY 186
Fly 187 EEDEVGDFDQPYDYGSILHYSSLAFSINGEATIVALNPEGQEQMGQRLMMSDTDVKRLNTMY 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7631 | NP_609760.1 | Astacin | 57..251 | CDD:279708 | 69/199 (35%) |
ZnMc_astacin_like | 61..248 | CDD:239807 | 66/193 (34%) | ||
hch-1 | NP_510440.1 | Astacin | 132..323 | CDD:279708 | 69/199 (35%) |
ZnMc_astacin_like | 135..320 | CDD:239807 | 66/193 (34%) | ||
CUB | 386..466 | CDD:214483 | |||
TSP1 | 533..565 | CDD:214559 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10127 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.910 |