DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and nas-10

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001257126.1 Gene:nas-10 / 181287 WormBaseID:WBGene00003529 Length:540 Species:Caenorhabditis elegans


Alignment Length:253 Identity:68/253 - (26%)
Similarity:106/253 - (41%) Gaps:33/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FQLFLLGTLCSGIFPAPFNTHYDETDPELTAGYFQGDMDVDYARNGQLSETRRWPNAT-VPYRIS 69
            |.|..||....|..|.|     .....:..:.:|:.::            .::||:.: :||...
 Worm   269 FMLNELGKGGEGAIPMP-----GSAKAKRASIFFEQNL------------IQKWPSTSPIPYTFD 316

  Fly    70 EEFDAPHVEYIKLGMQFIEYSSCIRF----VPADEDEENYLFVLPSTSGCS-SKVGYQPGERTVK 129
            ...|......::..:..||..:||||    .|...:..||..| .|.|.|. |.:|     |...
 Worm   317 SSLDNLDQNDVRGAISEIEQKTCIRFKYFASPPKGNHINYQKV-NSPSFCGLSYIG-----RVEP 375

  Fly   130 LKPGSLDTGCFK-LGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGD 193
            ..|..|...|.. .|...||.:|.||.:||....:||:.:|:...||:......||..:......
 Worm   376 ANPVYLSFQCGNGRGIAVHETMHALGVNHQHLRMDRDKHIKVDWSNINPQQYDAFVVADSKLYTT 440

  Fly   194 FDQPYDYGSILHYSSLAFSIN-GEATIVAL-NPEGQ-EQMGQRLMMSDTDVKRLNTMY 248
            :...|.|.||:||::...::| .:.|::.| |.:.. ..:|||..||:.||:.||.||
 Worm   441 YGVKYAYDSIMHYNAYTGAVNIAKPTMIPLVNQQANIGLLGQRAKMSNADVEILNKMY 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 60/202 (30%)
ZnMc_astacin_like 61..248 CDD:239807 56/196 (29%)
nas-10NP_001257126.1 Astacin 303..501 CDD:396122 60/202 (30%)
ShK 503..540 CDD:396228
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.