DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and nas-11

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001024789.1 Gene:nas-11 / 180938 WormBaseID:WBGene00003530 Length:579 Species:Caenorhabditis elegans


Alignment Length:260 Identity:67/260 - (25%)
Similarity:99/260 - (38%) Gaps:48/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PAPFNTHYDETDPELT----------------AGYFQGDMDVDYARNGQLSETRRW-PNATVPYR 67
            |.|.....||.|.:.|                |.||:|::            .::| |::.:.|.
 Worm   298 PLPDADTDDEDDDDSTNSASGAAPGSSRLKKSALYFEGNL------------IKKWDPSSPIRYV 350

  Fly    68 ISEEFDAPHVEYIKLGMQFIEYSSCIRF-----VPADEDEENYLFVLPSTSGCSSKVGYQPGERT 127
            :....:......::..:..||.::||||     .|.......|....|:..|. |.||     |.
 Worm   351 LDSSLEDLDKNDVRAAIYEIEKNTCIRFKELSSPPTGSHIVYYKVDSPTFCGL-SYVG-----RA 409

  Fly   128 VKLKPGSLDTGC-FKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEV 191
            ....|..|..|| ...|...||.:|.||..||....:||:|:.|...||.......||..:....
 Worm   410 DPANPVYLSFGCDNNKGVAIHETMHALGVAHQHLRNDRDQFITINWSNIDPQQYDAFVVVDSKLY 474

  Fly   192 GDFDQPYDYGSILHYSSLAFSINGEATIVALNPE-----GQEQMGQRLMMSDTDVKRLNTMYKCP 251
            ..:...|.|.||:||:....:.|  ..|..:||:     ..:.:|||..|..||::.|..||..|
 Worm   475 TSYGVKYAYDSIMHYNGYTAAQN--IAIPTMNPKTNSAVNLKVLGQRQKMGTTDIELLKKMYCQP 537

  Fly   252  251
             Worm   538  537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 56/205 (27%)
ZnMc_astacin_like 61..248 CDD:239807 52/197 (26%)
nas-11NP_001024789.1 Astacin 339..537 CDD:279708 56/205 (27%)
ZnMc_astacin_like 346..534 CDD:239807 52/195 (27%)
ShK 538..575 CDD:279838 67/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.