DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and nas-15

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_508154.2 Gene:nas-15 / 180426 WormBaseID:WBGene00003534 Length:571 Species:Caenorhabditis elegans


Alignment Length:268 Identity:84/268 - (31%)
Similarity:130/268 - (48%) Gaps:33/268 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FLLGTLCSGIFPAPFNTHYDETDPELTAGYFQGDMDVD---------YARNGQ------------ 52
            |.|||..:............::|...:...|:||:..|         :|..|.            
 Worm    52 FELGTRITAAMAHDNGDDIWDSDAMYSKDRFEGDIANDNLNASTAELFANGGSGKSEDGKWYNAI 116

  Fly    53 LSETRRWPNATVPYRISEEFDAPHVEYIKLGMQFIEYSS--CIRFVPADEDEENYLFVLPSTSGC 115
            .:..:.||...:||.||.::.:.....|...||  ||:|  |||:||.:..:.||:.:.|. .||
 Worm   117 KNRLQLWPEGRIPYTISSQYSSYSRSLIAASMQ--EYASHTCIRWVPKEAADVNYVHIYPD-RGC 178

  Fly   116 SSKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHE 180
            .|.||...|::::     ||.:||.:.|.|.|||:|.:||.|:|...:||:.:.|:..||..|.:
 Worm   179 YSMVGKMGGKQSL-----SLGSGCIQKGIILHELMHAVGFFHEQSRTDRDDHITIMWNNIQAGMQ 238

  Fly   181 KNFVKYEEDEVGDFDQPYDYGSILHYSSLAFSINGEATIVALNPEGQEQMGQRLMMSDTDVKRLN 245
            ..|.||....:......||||||:||.:.|||.||:.|::.  .:....:|||...|..|..::|
 Worm   239 GQFEKYGHGTIQSLGTGYDYGSIMHYGTKAFSRNGQPTMIP--KKNGATIGQRNGFSKVDKFKIN 301

  Fly   246 TMYKCPIQ 253
            |:|.||::
 Worm   302 TLYGCPVE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 71/195 (36%)
ZnMc_astacin_like 61..248 CDD:239807 68/188 (36%)
nas-15NP_508154.2 Astacin 121..308 CDD:279708 72/196 (37%)
ZnMc_astacin_like 126..304 CDD:239807 68/187 (36%)
ShKT 354..388 CDD:214586
ShK 436..471 CDD:279838
Gag_MA <472..531 CDD:279482
ShK 535..571 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.