DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and nas-38

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001359993.1 Gene:nas-38 / 180407 WormBaseID:WBGene00003554 Length:727 Species:Caenorhabditis elegans


Alignment Length:249 Identity:68/249 - (27%)
Similarity:105/249 - (42%) Gaps:29/249 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NT--HYDETDPELTAGYFQGDMDV---------DYARNGQLSET--------RRW-PNATVPYRI 68
            ||  |:||........|||||:|:         |....|:..:.        ::| ....:.:..
 Worm    70 NTGVHHDELAVNNADEYFQGDVDLSEQQVKIIEDQFTQGKREKRKIGRNPLYKKWDTRGPISFDY 134

  Fly    69 SEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVGYQPGERTVKLKPG 133
            :|.......:.|:..|...:..:|:||.....:.:...|.  ...||||.||...|.:.:     
 Worm   135 AESIPFQTRQKIRSAMLLWQQHTCLRFEEGGPNVDRLEFF--DGGGCSSFVGRVGGTQGI----- 192

  Fly   134 SLDT-GCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFDQP 197
            |:.| ||..:|.|.||:.|.||..|:|..|:::..:.|...||......||....|:....::.|
 Worm   193 SISTPGCDVVGIISHEIGHALGIFHEQARPDQERHIAINYNNIPLSRWNNFQAVGENHAETYNLP 257

  Fly   198 YDYGSILHYSSLAFSING-EATIVALNPEGQEQMGQRLMMSDTDVKRLNTMYKC 250
            ||.||::||....|:.:. ..||..|....|..:|||...|..|.:.:|..|.|
 Worm   258 YDTGSVMHYGPYGFASDPYTPTIRTLERVQQSTIGQRAGPSFLDYQAINMAYGC 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 55/197 (28%)
ZnMc_astacin_like 61..248 CDD:239807 52/188 (28%)
nas-38NP_001359993.1 Astacin 122..313 CDD:366617 55/197 (28%)
CUB 367..466 CDD:214483
TSP1 613..658 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.