DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and nas-9

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_741532.1 Gene:nas-9 / 178875 WormBaseID:WBGene00003528 Length:546 Species:Caenorhabditis elegans


Alignment Length:219 Identity:63/219 - (28%)
Similarity:94/219 - (42%) Gaps:26/219 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RNG---QLSETRRW----PNATVPYRISEEFDAPHVEYIKLGMQFIEYSSCIRF----VPADEDE 102
            |:|   |.|..::|    |   :.|.:.:..:....:.|:..:..|..::||.|    .|... .
 Worm   300 RSGVFFQESAVQKWDIWKP---IQYTLDDSLEESDKKDIRDALHEISINTCILFRYNATPKGY-H 360

  Fly   103 ENYLFVLPSTSGCS-SKVGYQPGERTVKLKPGSLDTGC-FKLGTIQHELLHTLGFHHQQCSPNRD 165
            .||:.| .||:.|. |.||     ||....|..|...| ...|...||.:|.||..||....:||
 Worm   361 LNYMKV-DSTTFCGLSYVG-----RTDPANPIYLSFQCGDNRGVAMHETMHALGVSHQHLRLDRD 419

  Fly   166 EFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSL--AFSINGEATIVALNP-EGQ 227
            :::||...||...|...|...:......:...|.|.||:||::.  |...|....|..:|| |..
 Worm   420 KYIKIDWSNIDPQHYDTFAISDAKLYTSYGTKYAYDSIMHYNAYLGAKDPNKPTMIPLVNPQENT 484

  Fly   228 EQMGQRLMMSDTDVKRLNTMYKCP 251
            .::|||..::..|::.|..||..|
 Worm   485 PKLGQRAKLTRGDIRLLKKMYCRP 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 58/206 (28%)
ZnMc_astacin_like 61..248 CDD:239807 54/195 (28%)
nas-9NP_741532.1 Astacin 311..505 CDD:279708 56/203 (28%)
ZnMc_astacin_like 316..505 CDD:239807 55/198 (28%)
ShKT 510..546 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.