DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and toh-1

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_497769.3 Gene:toh-1 / 175491 WormBaseID:WBGene00006591 Length:414 Species:Caenorhabditis elegans


Alignment Length:213 Identity:55/213 - (25%)
Similarity:98/213 - (46%) Gaps:26/213 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GQLSETRRWPNATVPYRI---SEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPST 112
            ||:.:   |.:..:|::|   ...|.:    .|:.|::..|.|:|:||....:..:...:||...
 Worm    66 GQIYD---WNSYEIPFQIWGGDYNFQS----LIRRGIRMWEDSTCLRFKENQQSRDAIRYVLEKG 123

  Fly   113 SGCSSK-VGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENIS 176
            ..|.:: :|...|.:.:     .:.:.|.:...:.||..|.|||.|....|:||..:.|..:|:.
 Worm   124 DSCFTEYIGRNGGHQDI-----IIGSECAEEYVVAHETGHALGFWHTHQRPDRDRHISINWKNVM 183

  Fly   177 EGHEKNFVKYEE-------DEVGDFDQPYDYGSILHYSSLAFSIN-GEATIVALNPEGQEQMGQR 233
            |....:|:.:..       .:|.....||||||::||.::|.::. .:.|||....:....||..
 Worm   184 EEATASFMPFRSMLQAFGIRQVSPRRVPYDYGSLMHYHAVAHAVKVSDFTIVPKELKYVTTMGTE 248

  Fly   234 LMMSDTDVKRLNTMYKCP 251
             .|:..|.|.:|.:| ||
 Worm   249 -KMAFLDAKVINDIY-CP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 51/205 (25%)
ZnMc_astacin_like 61..248 CDD:239807 49/198 (25%)
toh-1NP_497769.3 Astacin 71..265 CDD:279708 53/205 (26%)
ZnMc_astacin_like 73..262 CDD:239807 49/198 (25%)
CUB 320..410 CDD:214483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.