DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and nas-25

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_495880.1 Gene:nas-25 / 174412 WormBaseID:WBGene00003544 Length:399 Species:Caenorhabditis elegans


Alignment Length:254 Identity:74/254 - (29%)
Similarity:120/254 - (47%) Gaps:29/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QLFLLGTLCSGIFPAPFNTHYDETDPELTAGYFQ-----GDMDVDYARNGQLSETRRWPNATVPY 66
            |::|..|:|.    ..|.|..|...|     |::     |.:.....|..|...|.||||.||||
 Worm     2 QIYLGITICL----VAFLTVIDCAIP-----YYRTHSNFGSLGRRKVRQVQRDLTYRWPNNTVPY 57

  Fly    67 RISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADE---DEENYLFVLPSTSGCSSKVGYQP-GERT 127
            .:. ...:...:.::|.::.::..:||||...:|   |.::...|  ....|||.:|.|. |.:.
 Worm    58 YVG-NVTSTIKKSVRLAIEELQAWTCIRFQNVNEKYSDGDSVRIV--DLGSCSSPIGRQQIGTQD 119

  Fly   128 VKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVG 192
            |     ||...|:.:||..|||:|.:|..|.|...:|:.::.|:.:||......||.........
 Worm   120 V-----SLTKNCWGMGTAIHELMHAIGIEHTQSRSDRNRYLDILAQNIDNRDLPNFELLSPRLWA 179

  Fly   193 DFDQPYDYGSILHYSSLAFS-INGEATIVALNPEGQEQMGQRLMMSDTDVKRLNTMYKC 250
            :. .||||||::|||:.:|| .:.|.|::..:....|.||. ::.:..|..::|..|:|
 Worm   180 NL-VPYDYGSVMHYSADSFSNKDDEQTMLPKDRSFIETMGS-MIPNFYDFDQINQYYQC 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 61/199 (31%)
ZnMc_astacin_like 61..248 CDD:239807 56/191 (29%)
nas-25NP_495880.1 Astacin 48..236 CDD:279708 60/197 (30%)
ZnMc_astacin_like 52..234 CDD:239807 56/191 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.