DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and Mep1a

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_032611.2 Gene:Mep1a / 17287 MGIID:96963 Length:760 Species:Mus musculus


Alignment Length:270 Identity:85/270 - (31%)
Similarity:123/270 - (45%) Gaps:32/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IRVWFQLFLLGTLCSGIFPAP---------FNTHYDETDP---------ELTAG--YFQGDMDVD 46
            |.:|.|   ...|.|.||.|.         .|....:||.         .|.||  .||||:.:.
Mouse    13 IMLWIQ---PACLLSLIFSAHIAAVSIKHLLNGSDHDTDVGEQKDIFEINLAAGLNLFQGDILLP 74

  Fly    47 YARNGQLSETRRWPNATVPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPS 111
            ..||.....:.|| ...:||.:::..:......|....:.....||:.|.|. |.|.:|: :...
Mouse    75 RTRNAMRDPSSRW-KLPIPYILADNLELNAKGAILHAFEMFRLKSCVDFKPY-EGESSYI-IFQK 136

  Fly   112 TSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENIS 176
            .|||.|.:|.|...:.:     |:..||....||:||:||.|||.|:|...:||::|.|..:.|.
Mouse   137 LSGCWSMIGDQQVGQNI-----SIGEGCDFKATIEHEILHALGFFHEQSRTDRDDYVNIWWDQII 196

  Fly   177 EGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFSINGE-ATIVALNPEGQEQMGQRLMMSDTD 240
            ..:|.||..|:::.:.|.:.||||.|::||...:|:.|.. .||....||....:||....|..|
Mouse   197 TDYEHNFNTYDDNTITDLNTPYDYESLMHYGPFSFNKNESIPTITTKIPEFNTIIGQLPDFSAID 261

  Fly   241 VKRLNTMYKC 250
            :.|||.||.|
Mouse   262 LIRLNRMYNC 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 65/195 (33%)
ZnMc_astacin_like 61..248 CDD:239807 60/187 (32%)
Mep1aNP_032611.2 ZnMc 46..271 CDD:381785 75/232 (32%)
MAM 281..444 CDD:366209
MATH 443..607 CDD:351761
EGF 688..722 CDD:333761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.