DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and astl2d.2

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_031756346.1 Gene:astl2d.2 / 105947175 XenbaseID:XB-GENE-22069740 Length:517 Species:Xenopus tropicalis


Alignment Length:219 Identity:75/219 - (34%)
Similarity:116/219 - (52%) Gaps:17/219 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QGDMDVDYARNGQLSETRRWPNAT----VPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADE 100
            |||:.|..:|:..:.....|..:.    |||.:.:::.:..:..|...|:.....:|::|||. .
 Frog    80 QGDIAVRVSRSTIVCTDCFWQKSNGIVYVPYTLDKQYSSDQINTITSAMEVYSTLTCVQFVPY-T 143

  Fly   101 DEENYLFVLPSTSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRD 165
            |||:|: .:.|..||.|.:|.|.|.:.|.::.|.    |...||..|||.|.|||.|:|...:||
 Frog   144 DEEDYI-AITSGDGCWSYMGRQGGAQVVSVEKGY----CTSEGTTMHELNHALGFVHEQSRSDRD 203

  Fly   166 EFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFS-INGEATIVA-LNPEGQE 228
            .:|.|:.:.||.|...||.|.   |..:.:..|||.||:||.:.||| ..|:.|||| |||  ..
 Frog   204 NYVDIMYQYISPGDIVNFKKM---ETNNLNTTYDYHSIMHYPAWAFSNTTGQNTIVAKLNP--NT 263

  Fly   229 QMGQRLMMSDTDVKRLNTMYKCPI 252
            .:|....|::.|:.::|.:|:|.:
 Frog   264 PLGPGSTMTNLDITKINRLYQCDV 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 69/199 (35%)
ZnMc_astacin_like 61..248 CDD:239807 67/192 (35%)
astl2d.2XP_031756346.1 ZnMc 103..285 CDD:412141 68/192 (35%)
CUB 288..399 CDD:238001 75/219 (34%)
CUB 402..513 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.