DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and LOC105946018

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_031756313.1 Gene:LOC105946018 / 105946018 -ID:- Length:583 Species:Xenopus tropicalis


Alignment Length:264 Identity:77/264 - (29%)
Similarity:120/264 - (45%) Gaps:45/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FNTHYDETDPELTAGYFQG----------------------------DMDVDYARNGQLSETRRW 59
            ::..||....||...:.:|                            |:.|..:|:...|....|
 Frog    96 YSLGYDHQKRELCVSFLEGKSDPFGQGDVFSRILKANQGNGVPRVQEDIAVGVSRSAITSTECLW 160

  Fly    60 --PNAT--VPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVG 120
              .|.|  |||.:..::....|..:...|:.....:|::|||. .||::|:.: .|..||.|.:|
 Frog   161 QKTNETVYVPYTLDSKYSNSEVNTMTSAMEVYATLTCVQFVPY-TDEDDYVNI-TSGDGCWSYMG 223

  Fly   121 YQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVK 185
            .|.|.:.|.::.|.    |...||..|||.|.|||.|:....:||.:|.|:.:.||.|   :.|.
 Frog   224 RQGGAQVVSVEKGY----CTSEGTTMHELNHALGFVHEHSRSDRDNYVNIMYQYISPG---DIVN 281

  Fly   186 YEEDEVGDFDQPYDYGSILHYSSLAFS-INGEATIVA-LNPEGQEQMGQRLMMSDTDVKRLNTMY 248
            :|.....:.:..|||.||:||.:.||| ..|:.|||| |||  ...:|....|:..|:.::|.:|
 Frog   282 FEIMNTNNLNTIYDYRSIMHYPAWAFSNTTGKNTIVAKLNP--NIIIGAGSTMTSLDIIKINRLY 344

  Fly   249 KCPI 252
            :|.:
 Frog   345 ECDV 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 67/199 (34%)
ZnMc_astacin_like 61..248 CDD:239807 65/190 (34%)
LOC105946018XP_031756313.1 C2 92..>113 CDD:417471 4/16 (25%)
ZnMc 164..346 CDD:412141 66/192 (34%)
CUB 349..458 CDD:395345 77/264 (29%)
CUB 463..574 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.