DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and accs

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_017948750.2 Gene:accs / 100495810 XenbaseID:XB-GENE-989873 Length:492 Species:Xenopus tropicalis


Alignment Length:266 Identity:74/266 - (27%)
Similarity:124/266 - (46%) Gaps:35/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLGTLCSGIFPA-----PFNTHYDE-------------TDPELTAGYFQGDMDVDYARNGQLSET 56
            |:|.:|   ||.     |...:.||             ::.......:|||:.::..|:.....:
 Frog     7 LIGCIC---FPVAVDQLPSGNYEDEEAYHEDVFSQILKSNNGTVKKLWQGDIAIETGRSATKCTS 68

  Fly    57 RRWPNAT-----VPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCS 116
            ..||.:.     ||||:|.::.......|:..:......:|:.||.. ..||::|.:: |.|||.
 Frog    69 CLWPKSADGTVRVPYRLSADYSDNEKSSIRDALLEFNTLTCVHFVER-STEEDFLDIV-SDSGCW 131

  Fly   117 SKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEK 181
            |.:|...|.:|:.|    :.:||...|.||||:.|.|||:|:|...:||.::.::.:.|.|....
 Frog   132 SSIGRTGGAQTLSL----MSSGCLAKGIIQHEVDHALGFYHEQSRSDRDTYIDVLWQYICESDWG 192

  Fly   182 NFVKYEEDEVGDFDQPYDYGSILHYSSLAFSINGEATIVALNPEGQEQMGQRLMMSDTDVKRLNT 246
            :|...:.|   :.|.||||.|::||...|||.......:...|:....:|||..:|..||.::..
 Frog   193 SFEMVDTD---NLDLPYDYSSVMHYGWYAFSNTSGQPSLRPKPDPTANIGQRYGLSPLDVSKVKE 254

  Fly   247 MYKCPI 252
            :|.|.:
 Frog   255 LYGCKL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 61/198 (31%)
ZnMc_astacin_like 61..248 CDD:239807 58/191 (30%)
accsXP_017948750.2 ZnMc 76..258 CDD:412141 59/190 (31%)
CUB 261..374 CDD:238001 74/266 (28%)
CUB 377..488 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.