DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and astl2f

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_002934133.3 Gene:astl2f / 100495416 XenbaseID:XB-GENE-22069764 Length:624 Species:Xenopus tropicalis


Alignment Length:230 Identity:81/230 - (35%)
Similarity:114/230 - (49%) Gaps:16/230 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ETDPELTAGYFQGDMDVDYARNGQLSETRRWPNAT-----VPYRISEEFDAPHVEYIKLGMQFIE 88
            |.:.:......|||:.....|:.....:..||.||     |||.|:..||....|.|:..:..:.
 Frog   173 EANKDTNVPLVQGDILEKLGRSTTNCTSCLWPRATSGLVNVPYTIASVFDDSEQELIQGALNELM 237

  Fly    89 YSSCIRFVPADEDEENYLFVLPSTSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTL 153
            ..||||| .|...|.::| ...|.:||.|.||...|.:.|.:.    .:||...|.||||.||.|
 Frog   238 TLSCIRF-KARTIETDFL-SFQSGNGCWSSVGKTGGSQEVSVS----KSGCMSHGIIQHETLHAL 296

  Fly   154 GFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAF-SINGEA 217
            ||.|:.|..:||.:|.|:.:.||||...:|.|...:.:|   ..|||.|::||....| :..|:|
 Frog   297 GFIHEHCRSDRDNYVDIIYKYISEGDRSSFTKVNSNNLG---LQYDYSSVMHYGRFTFTNTPGQA 358

  Fly   218 TIVALNPEGQEQMGQRLMMSDTDVKRLNTMYKCPI 252
            ||:. .|:....:|||..:|..||.:||.:|.|.|
 Frog   359 TIIP-KPDLSVPIGQRYGVSSLDVAKLNKLYNCNI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 74/199 (37%)
ZnMc_astacin_like 61..248 CDD:239807 71/192 (37%)
astl2fXP_002934133.3 ZnMc 209..390 CDD:412141 70/190 (37%)
CUB 394..504 CDD:238001
CUB 507..621 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.