DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and astl3c

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_002937470.2 Gene:astl3c / 100491451 XenbaseID:XB-GENE-22069695 Length:533 Species:Xenopus tropicalis


Alignment Length:224 Identity:75/224 - (33%)
Similarity:117/224 - (52%) Gaps:18/224 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LTAGYFQGDMDVDYARNGQLSETRRWPNA-----TVPYRISEEFDAPHVEYIKLGMQFIEYSSCI 93
            ||.|   ||:.::..|:...|: ..||.:     .|||..|..:.|..:...|..||..|..:|:
 Frog    73 LTEG---GDILINIGRSATSSD-YLWPKSADGTVVVPYIFSYNYSADELTLFKTAMQEFETLTCV 133

  Fly    94 RFVPADEDEENYLFVLPSTSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQ 158
            |||| ...:.::|.:: |..||.|.||...|.:.|:|    ...||...|.|||||.|.|||:|:
 Frog   134 RFVP-KTIQRDFLNIV-SNGGCLSMVGRNGGGQKVEL----ASYGCMSRGVIQHELNHALGFYHE 192

  Fly   159 QCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFSINGEATIVALN 223
            ....:||::|.|:.|||...:|..|.|.:.:.:|..   |||.|::|||...|||:.:.:.:...
 Frog   193 HMRSDRDDYVTIITENIIPSYENYFSKRKTNNMGII---YDYNSVMHYSRNTFSISPDKSTIVPK 254

  Fly   224 PEGQEQMGQRLMMSDTDVKRLNTMYKCPI 252
            |:....:|||..:|..|:.::..:|:|.:
 Frog   255 PDPSIPIGQRDGLSILDILKIKKLYQCDV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 67/198 (34%)
ZnMc_astacin_like 61..248 CDD:239807 64/191 (34%)
astl3cXP_002937470.2 ZnMc 99..281 CDD:381785 65/190 (34%)
CUB 290..393 CDD:366096
CUB 398..508 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.