DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and astl3b.4

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_031746772.1 Gene:astl3b.4 / 100491283 XenbaseID:XB-GENE-22069691 Length:533 Species:Xenopus tropicalis


Alignment Length:233 Identity:84/233 - (36%)
Similarity:122/233 - (52%) Gaps:15/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 THYDETDPELTAGYFQGDMDVDYARNGQLSETRRWPNAT-----VPYRISEEFDAPHVEYIKLGM 84
            |...:.:..::...::||:.....|:........||.:|     |||..|..:.|..:...|..|
 Frog    80 TQISKVNRGISVPTYEGDILRPEGRSAMNCTECLWPKSTDGTVIVPYNFSSNYSADQLALFKSAM 144

  Fly    85 QFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTIQHEL 149
            |..|..:|:||||. .:|..:|.:: |.|||.|.:|...|.:||:|    ...||...|.|||||
 Frog   145 QEYESLTCVRFVPR-ANETAFLNII-SGSGCVSFLGKLGGAQTVQL----ASYGCIYRGIIQHEL 203

  Fly   150 LHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFSIN 214
            .|.|||:|:|...:||::|.|..|||..|:|.||.|...:.:|   ..|||.|::||...|||.|
 Frog   204 NHALGFYHEQSRSDRDDYVTIHTENILPGYEGNFNKANTNNLG---LEYDYSSVMHYPGDAFSKN 265

  Fly   215 GEATIVALNPEGQEQMGQRLMMSDTDVKRLNTMYKCPI 252
            |..|||. .|:....:|||..:|..||.::|.:|:|.:
 Frog   266 GNLTIVP-KPDPTVPIGQRDGLSILDVSKINRLYQCDV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 79/198 (40%)
ZnMc_astacin_like 61..248 CDD:239807 76/191 (40%)
astl3b.4XP_031746772.1 ZnMc_hatching_enzyme 119..300 CDD:239810 76/190 (40%)
CUB 304..412 CDD:238001
CUB 417..525 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.