DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and XB5949052

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_002932488.2 Gene:XB5949052 / 100489456 XenbaseID:XB-GENE-5949053 Length:453 Species:Xenopus tropicalis


Alignment Length:282 Identity:86/282 - (30%)
Similarity:135/282 - (47%) Gaps:49/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFLLGTLCSG--IFPA--PFNTHYDETD-PELTAG-----------------------YFQGDMD 44
            :.|...||..  .||.  |..|..:.|: .:.|||                       |...::|
 Frog     4 VLLFAALCGSCLAFPTQKPNETPIEPTERNQATAGEENKSMFDRLYEVNKDALPFTGKYIVSNLD 68

  Fly    45 VDYARNGQLSET-----RRWPNAT-----VPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPAD 99
            : ..:.|:.:.|     ..||.::     :||.||.::.:......:...:....::|||.||. 
 Frog    69 I-ALKLGKSANTCPKGICLWPKSSDGLVRIPYVISSDYSSYSNALFQASFKGFADTTCIRLVPR- 131

  Fly   100 EDEENYLFVLPSTSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNR 164
            ..|.:|| ...|.:||.|.:|...|.:||.::    .:||.....|:||::|:||.||:....:|
 Frog   132 TSETDYL-SFESLNGCWSPIGRTGGAQTVSVQ----QSGCMWTSIIEHEIIHSLGLHHEHVRSDR 191

  Fly   165 DEFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFSINGE-ATIVALNPEGQE 228
            |::|.:...|||.|:..||...:.:.:.  ...|||.|::||||.||||||. .|::|: |:...
 Frog   192 DKYVSVQWNNISPGNTGNFQMTDTNNMN--LTKYDYNSLMHYSSTAFSINGNLPTLIAV-PDSSV 253

  Fly   229 QMGQRLMMSDTDVKRLNTMYKC 250
            ..|...||||.|:|:|||:|||
 Frog   254 SFGNAFMMSDLDIKKLNTLYKC 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 71/200 (36%)
ZnMc_astacin_like 61..248 CDD:239807 66/192 (34%)
XB5949052XP_002932488.2 ZnMc 92..275 CDD:412141 67/191 (35%)
CUB 342..452 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.