DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and LOC100003133

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_001342763.2 Gene:LOC100003133 / 100003133 -ID:- Length:276 Species:Danio rerio


Alignment Length:279 Identity:92/279 - (32%)
Similarity:135/279 - (48%) Gaps:44/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFLLGTLCSGI-------FPAPFNTHYDE--------TDPELTAGYFQGDMDVD--YARNGQLSE 55
            |||.|| |..:       |.|.....|.|        .|..:....:||...||  ..|.|.::.
Zfish     9 LFLAGT-CLSLPSQVSPNFGARRQRSYSEDIEENQTAMDRIIDVNDYQGVFSVDGTNLREGDIAV 72

  Fly    56 TRR-----------WP-----NATVPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEEN 104
            :.|           |.     |..:.|.:|..:|...|:.||.||:.||..:|:||||... :.:
Zfish    73 SGRSQKNCFARSCLWTKSVDGNVYIAYSLSHAYDDADVKNIKEGMELIEQDTCVRFVPRTH-QRD 136

  Fly   105 YLFVLPSTSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVK 169
            ||.:.|.| ||.|.:|.:.|.:|:.|:    ...|...|...|||:|.|||.|:|...:||::|.
Zfish   137 YLDIQPKT-GCWSYLGARGGRQTISLQ----SPDCTGSGVTVHELMHALGFVHEQSRADRDKYVT 196

  Fly   170 IVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFSINGEATIVALNPEGQEQMGQRL 234
            |:..||.:...:||.|:   :..:.|.||||.|::|:...|||.:||.|||. ......::||||
Zfish   197 IMWSNIWKDRLRNFEKF---KTNNLDTPYDYSSVMHFGKYAFSEDGEPTIVP-KRNWNVKIGQRL 257

  Fly   235 MMSDTDVKRLNTMYKCPIQ 253
            ..||.|:.::|.:|.|.:|
Zfish   258 GPSDLDIMKINKLYSCNMQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 73/209 (35%)
ZnMc_astacin_like 61..248 CDD:239807 70/186 (38%)
LOC100003133XP_001342763.2 ZnMc_hatching_enzyme 92..273 CDD:239810 71/190 (37%)
Astacin 97..274 CDD:279708 70/186 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.