DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or98b

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:308 Identity:68/308 - (22%)
Similarity:123/308 - (39%) Gaps:74/308 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 KMIINR------LVSAMYG-----AVISLYLIAPVFSIINQSK------DFLYSMIFPFDSDPLY 180
            :||:.|      .:||||.     |.:|..|::|:..:|:..:      .|.:..::|:|:..|.
  Fly   111 EMIVTRESRRDQFISAMYAYCFITAGLSACLMSPLSMLISYQRTGELQPKFPFPSVYPWDNMKLS 175

  Fly   181 IFVPLLLTNVWVG-------IVIDTMMFGETNLLCELIVHLNGSYMLLKRDLQLAIEKIL--VAR 236
            .::.....||...       :.:||:....::.||.|              .|:|..|::  ..|
  Fly   176 NYIISYFWNVCAALGVALPTVCVDTLFCSLSHNLCAL--------------FQIARHKMMHFEGR 226

  Fly   237 DRPHMAKQLK---VLITKTLRKNVALNQFGQQLEAQYTVRVFIMFAFAAGL-LCALSFKAYTNPM 297
            :.....:.||   .|....|.....||::.:.|..|:.         ||.| ||.|.::...|.:
  Fly   227 NTKETHENLKHVFQLYALCLNLGHFLNEYFRPLICQFV---------AASLHLCVLCYQLSANIL 282

  Fly   298 --ANYIYAIWFGAKTVELLSLGQI------GSDLAFTTDSLSTMYYLTHWEQILQYSTNPSENLR 354
              |...||.:..|      .:||:      ||.:...........|.:.|..:||      |||:
  Fly   283 QPALLFYAAFTAA------VVGQVSIYCFCGSSIHSECQLFGQAIYESSWPHLLQ------ENLQ 335

  Fly   355 LLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTSM 402
            |:..:.:|:..:|....:.|. :|..:.:..:.|::.:.||.|.|.|:
  Fly   336 LVSSLKIAMMRSSLGCPIDGY-FFEANRETLITIVRTAISYVTLLRSL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 63/297 (21%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 63/296 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.