DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or98a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:418 Identity:74/418 - (17%)
Similarity:147/418 - (35%) Gaps:114/418 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PSTGKWGRYLDKVLAVAMSLVFMQHNDAELRYLRFEASNRNLDAFLTGMPTYLILVEAQFRSLHI 98
            |:|.|...|:...|..|...|::...    ..:.|:.   :::.|   .|..|:.|        :
  Fly    36 PATHKIIYYITSCLIFAWCAVYLPIG----IIISFKT---DINTF---TPNELLTV--------M 82

  Fly    99 LLHFEKLQKFLEIFYANIYIDP-RKEPEMFRKVDGK--------------------MIINRLVSA 142
            .|.|..:....::.:.|:||.. .|..::..::|.:                    .:|.:.:..
  Fly    83 QLFFNSVGMPFKVLFFNLYISGFYKAKKLLSEMDKRCTTLKERVEVHQGVVRCNKAYLIYQFIYT 147

  Fly   143 MYGAVISLYLIAPV-----FSIINQSKDFLYSMIFPFDSDPLYIFVPLLLTNVWVGIVIDT--MM 200
            .|  .||.:|.|.:     :.|.|...||..|.                 ::.|...:.:|  |:
  Fly   148 AY--TISTFLSAALSGKLPWRIYNPFVDFRESR-----------------SSFWKAALNETALML 193

  Fly   201 FGETNLLCE----------LIVHLNGSYMLLKRDLQLAIEKILVARDRPHMAKQLKVLITKTLRK 255
            |..|..|..          |.|||        :.|:|.:|.:.....:.....:..::  |.::.
  Fly   194 FAVTQTLMSDIYPLLYGLILRVHL--------KLLRLRVESLCTDSGKSDAENEQDLI--KCIKD 248

  Fly   256 NVALNQFGQQLEAQYTVRVFIMFAFAAGLLCALSFKAYTNPMANYIY--AIWFGAKTVELLSLGQ 318
            :..:..:...:....|..:|:.| ...|:...||       |.|.::  .||.|..||..::...
  Fly   249 HNLIIDYAAAIRPAVTRTIFVQF-LLIGICLGLS-------MINLLFFADIWTGLATVAYINGLM 305

  Fly   319 IGS-DLAFTTDSL--------STMYYLTHWEQILQYSTNPSENLRLLKLINLAIEMNSKPFYVTG 374
            :.: ...|..|.|        |.::: ::|   :..|.:...:||..      ::...|....|.
  Fly   306 VQTFPFCFVCDLLKKDCELLVSAIFH-SNW---INSSRSYKSSLRYF------LKNAQKSIAFTA 360

  Fly   375 LKYFRVSLQAGLKILQASFSYFTFLTSM 402
            ...|.:|..:.:|:.:.:||..||:..:
  Fly   361 GSIFPISTGSNIKVAKLAFSVVTFVNQL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 62/367 (17%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 61/359 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465997
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.