DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or94a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:397 Identity:72/397 - (18%)
Similarity:132/397 - (33%) Gaps:141/397 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 RSLHILLHFEKLQKFLEIFYANIYIDPRKEPE---MFRKVDGKMIINRLVSAMYGAVISLYLI-- 153
            |:...|||......|:.:.:...:|....|..   ::..:....::.:::|..:....:..|:  
  Fly    42 RNYRFLLHLPITFTFIGLMWLEAFISSNLEQAGQVLYMSITEMALVVKILSIWHYRTEAWRLMYE 106

  Fly   154 ---APVFSIINQSK-----------------------------------------DFLYSMIFPF 174
               ||.:.:.||.:                                         .|.|.:.|.:
  Fly   107 LQHAPDYQLHNQEEVDFWRREQRFFKWFFYIYILISLGVVYSGCTGVLFLEGYELPFAYYVPFEW 171

  Fly   175 DSDPLYIF------VPLLLTNVWVGIVIDTMMFGETNLLCELIVHLNGSYMLLKRDLQLAIEKIL 233
            .::..|.|      ..:.||.: ..|.:||       |.|..:.|::..|.||            
  Fly   172 QNERRYWFAYGYDMAGMTLTCI-SNITLDT-------LGCYFLFHISLLYRLL------------ 216

  Fly   234 VARDRPHMAKQLKVLITKTLRKNVALNQFGQQLEAQYTVRVFIM-----------------FAFA 281
                      .|::..||.::.:..   |||||.|     :|||                 :..:
  Fly   217 ----------GLRLRETKNMKNDTI---FGQQLRA-----IFIMHQRIRSLTLTCQRIVSPYILS 263

  Fly   282 AGLLCAL--SFKAY--------TNPMANYIYAIWFGAKTVELLSLGQI------GSDLAFTTDSL 330
            ..:|.||  .|..|        .|| ..:|..:.|    |.::.| ||      |:::....:.|
  Fly   264 QIILSALIICFSGYRLQHVGIRDNP-GQFISMLQF----VSVMIL-QIYLPCYYGNEITVYANQL 322

  Fly   331 STMYYLTHWEQILQYSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSY 395
            :...|.|:|     ....|.    :.||:|..:|...||..:....:|.|.|...:|.:..::|:
  Fly   323 TNEVYHTNW-----LECRPP----IRKLLNAYMEHLKKPVTIRAGNFFAVGLPIFVKTINNAYSF 378

  Fly   396 FTFLTSM 402
            ...|.::
  Fly   379 LALLLNV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 70/386 (18%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 64/359 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466202
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.