DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or85f

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster


Alignment Length:341 Identity:63/341 - (18%)
Similarity:128/341 - (37%) Gaps:53/341 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 TYLILVEAQFRSLHILLHFEKLQKFLEIFYANIYIDPRKEPEMFRKVDGK-----------MIIN 137
            ||:|..:.:|.::......:.|...|...|....:|     .::.:|:..           :.|.
  Fly    81 TYIINSDTKFATVLQRSAIQSLNSKLAELYPKTTLD-----RIYHRVNDHYWTKSFVYLVIIYIG 140

  Fly   138 RLVSAMYGAVIS---LYLIAPVFSIINQSKDFLYSMIFPFDSDPLYIFVPLLLTNVWV---GIVI 196
            ..:..:.|.:|:   .|....||:.::....|||..    :.||::|::.:.... |:   .:||
  Fly   141 SSIMVVIGPIITSIIAYFTHNVFTYMHCYPYFLYDP----EKDPVWIYISIYALE-WLHSTQMVI 200

  Fly   197 DTMMFGETNLLCELIVHLNGSYMLLKRDLQLAIEKILVARDRPHMAKQLKVLITKTLRKNVALNQ 261
            ..:  |....|....|.:|..:..:.|  .||..|..|..|     ::.:..|.|.:.|.|.|..
  Fly   201 SNI--GADIWLLYFQVQINLHFRGIIR--SLADHKPSVKHD-----QEDRKFIAKIVDKQVHLVS 256

  Fly   262 FGQQLEAQYTVRVFIMFAFAAGLLCALSFKAYT---NP-MANYIYAIWFGAKTVELLSLGQIGSD 322
            ....|...:...:.:.....|.::|.::  .||   .| :..:.|.|:.|...:::..:...|..
  Fly   257 LQNDLNGIFGKSLLLSLLTTAAVICTVA--VYTLIQGPTLEGFTYVIFIGTSVMQVYLVCYYGQQ 319

  Fly   323 -LAFTTDSLSTMYYLTHWEQILQYSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGL 386
             |..:.:....:|.....:..:.|.       |.|.:|.:..:   :|..:..:.|..:||....
  Fly   320 VLDLSGEVAHAVYNHDFHDASIAYK-------RYLLIIIIRAQ---QPVELNAMGYLSISLDTFK 374

  Fly   387 KILQASFSYFTFLTSM 402
            :::..|:...|.|..|
  Fly   375 QLMSVSYRVITMLMQM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 59/330 (18%)
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 59/330 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.