DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or85d

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster


Alignment Length:290 Identity:48/290 - (16%)
Similarity:95/290 - (32%) Gaps:75/290 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 MYGAVISLYLIAPVFSIINQSKDFL-YSMIFPFDSDPLYIFVPLLLTNVWVGIVIDTMMFGETNL 206
            :|.||  .||:...:..:.|.:..| |....|:|....|.:..:.::....|....:.......|
  Fly   165 LYWAV--YYLVCDFWLGMRQFERMLPYYCWVPWDWSTGYSYYFMYISQNIGGQACLSGQLAADML 227

  Fly   207 LCELI-----------VHLN------GSYMLLKRDLQLAIEKILVARDRPHMAKQLKVLITKTLR 254
            :|.|:           .|:.      ||:   :.||:.....:...:...|:.:.:..:...:|.
  Fly   228 MCALVTLVVMHFIRLSAHIESHVAGIGSF---QHDLEFLQATVAYHQSLIHLCQDINEIFGVSLL 289

  Fly   255 KNVALNQFGQQLEAQYTVRVFIMFAFAAG------------LLCALSFKAYTNPMANYIYAIWFG 307
            .|...:.|         :..|:.|....|            |.||:                   
  Fly   290 SNFVSSSF---------IICFVGFQMTIGSKIDNLVMLVLFLFCAM------------------- 326

  Fly   308 AKTVELLSLGQIGSDLAFTTDSLSTMYYLTHWEQILQYSTNPSENLRLLKLINLAIEMNSKPFYV 372
               |::..:......|...::.:....|...|.:         .:||..|::.|.|:...:|..:
  Fly   327 ---VQVFMIATHAQRLVDASEQIGQAVYNHDWFR---------ADLRYRKMLILIIKRAQQPSRL 379

  Fly   373 TGLKYFRVSLQAGLKILQASFSYFTFLTSM 402
            ....:..:||.....:||.|:.:|..|.:|
  Fly   380 KATMFLNISLVTVSDLLQLSYKFFALLRTM 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 44/279 (16%)
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 44/279 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472812
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.