DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or85c

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_524280.2 Gene:Or85c / 41008 FlyBaseID:FBgn0037591 Length:389 Species:Drosophila melanogaster


Alignment Length:333 Identity:68/333 - (20%)
Similarity:127/333 - (38%) Gaps:77/333 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 LQKFLEIFYANIYIDPRKEPEMFRKVDGKMIINRLVSAMYGAVISLYL-IAPVFSIINQSKDFL- 167
            |.|.||    :||.:.:.|.||:| :|..:.....:|..|..:.|:.: ...:|||:    .|| 
  Fly    96 LVKELE----HIYPNGKAEEEMYR-LDRYLRSCSRISITYALLYSVLIWTFNLFSIM----QFLV 151

  Fly   168 ---------------YSMIFPFDSDPLYIFVPLLLTNVWVGIVIDTMMFGETNLLC----ELIVH 213
                           |.|.||::....:.:..||....:.|....:.......|||    ::::|
  Fly   152 YEKLLKIRVVGQTLPYLMYFPWNWHENWTYYVLLFCQNFAGHTSASGQISTDLLLCAVATQVVMH 216

  Fly   214 LNGSYMLLKRDLQLAIEKILVARDRPHMAKQLKVLI---TKTLRKNVALNQ-FGQQLEAQYTVRV 274
            .:  |      |...:||.::.||....::.|...:   .:.||....||. ||..|...:.|..
  Fly   217 FD--Y------LARVVEKQVLDRDWSENSRFLAKTVQYHQRILRLMDVLNDIFGIPLLLNFMVST 273

  Fly   275 FIM----FAFAAGLLCALSFKAYTNPMANYIYAIWFGAKTVELLSLGQI------GSDLAFTTDS 329
            |::    |....|:...:..|.:.     ::::           ||.|:      |..:|..:.|
  Fly   274 FVICFVGFQMTVGVPPDIMIKLFL-----FLFS-----------SLSQVYLICHYGQLIADASSS 322

  Fly   330 LSTMYYLTHWEQILQYSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFS 394
            ||...|..:|:         :.::|..:.:...|....:..|:....:..::......:||.|:.
  Fly   323 LSISAYKQNWQ---------NADIRYRRALVFFIARPQRTTYLKATIFMNITRATMTDLLQVSYK 378

  Fly   395 YFTFLTSM 402
            :|..|.:|
  Fly   379 FFALLRTM 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 64/322 (20%)
Or85cNP_524280.2 7tm_6 63..377 CDD:251636 64/322 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.