DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or85b

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster


Alignment Length:337 Identity:57/337 - (16%)
Similarity:123/337 - (36%) Gaps:82/337 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 EKLQKFLEIFYANIYIDPRKEPEMFRKVDGKMIINRLVSAMYGAVI---SLYLIAPVF------S 158
            |.:.:..||:...:..:.|....|:.....:  |:.:.|.:|..:|   :|:.:...:      :
  Fly    96 ELINELKEIYPNGLIREERYNLPMYLGTCSR--ISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLN 158

  Fly   159 IINQSKDFLYSMIFPFDSDPLYIFVPLLLTNVWVGIVIDTMMFGETNLLC----ELIVH------ 213
            |....|...|.|..|:.....:.:.|||.:..:.|............|||    :|::|      
  Fly   159 IRVVGKQLPYLMYIPWKWQDNWSYYPLLFSQNFAGYTSAAGQISTDVLLCAVATQLVMHFDFLSN 223

  Fly   214 ------LNGSYMLLKRDLQLAIEKILVARDRPHMAKQLKVLITKTLRKNVALNQ-FGQQLEAQYT 271
                  |:|.:   |:|.:..::.:     |.|         .:.||.:.|:|. ||..|...:.
  Fly   224 SMERHELSGDW---KKDSRFLVDIV-----RYH---------ERILRLSDAVNDIFGIPLLLNFM 271

  Fly   272 VRVFIMFAFAAGLLCALSFKAYTNPMANYIYAIWFGAKTVELLSLGQIGSDLAFTTDSLSTMYYL 336
            |..|:        :|.:.|:.......:.:..::.                  |...|:|.:|.:
  Fly   272 VSSFV--------ICFVGFQMTVGVPPDIVVKLFL------------------FLVSSMSQVYLI 310

  Fly   337 THWEQIL---QYSTNPS--------ENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQ 390
            .|:.|::   .|..:.:        .::|..:.:.:.|..:.|..::....:..::......:||
  Fly   311 CHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIARSQKVTFLKATIFLDITRSTMTDLLQ 375

  Fly   391 ASFSYFTFLTSM 402
            .|:.:|..|.:|
  Fly   376 ISYKFFALLRTM 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 53/326 (16%)
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 53/326 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472809
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.