DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or83c

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:267 Identity:57/267 - (21%)
Similarity:91/267 - (34%) Gaps:95/267 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 ISLYLIAPVFSIINQSKDFLYSMIFPFDSDPLYIFVPLLLTNVW-VGIVIDTMMFGETNLLCELI 211
            |:.|....||:|:|...|                         | ||:....|..|        :
  Fly    47 IANYTGFTVFTILNNGGD-------------------------WRVGLKASLMTGG--------L 78

  Fly   212 VHLNGSYM--LLK----RDLQLAIEKIL----VARDRPHMAKQLKVLITKTLRKNVALNQFGQQL 266
            .|..|.::  |||    |.|.|..:.|.    ...|..|          :||..|:     .:.|
  Fly    79 FHGLGKFLTCLLKHQDMRRLVLYSQSIYDEYETRGDSYH----------RTLNSNI-----DRLL 128

  Fly   267 EAQYTVRVFIMFAFAAGLLCALSFKAYTN-------------PMA-NYIYAIWFGAKTVELLSLG 317
            .....:|...:|||....|..|:...|..             |:. ||.|.:.:..:||.:|..|
  Fly   129 GIMKIIRNGYVFAFCLMELLPLAMLMYDGTRVTAMQYLIPGLPLENNYCYVVTYMIQTVTMLVQG 193

  Fly   318 QIGSDLAFTTDSLSTMYYLTHWEQILQYSTNPSENLRL-LKLINLAIEMNSKPFYVTGLKYFRVS 381
                 :.|.:..|.....||   |||.:    ::.|:: :|.:|.|:|..::         :|..
  Fly   194 -----VGFYSGDLFVFLGLT---QILTF----ADMLQVKVKELNDALEQKAE---------YRAL 237

  Fly   382 LQAGLKI 388
            ::.|..|
  Fly   238 VRVGASI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 57/267 (21%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 47/220 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465550
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.