DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Orco

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster


Alignment Length:515 Identity:85/515 - (16%)
Similarity:162/515 - (31%) Gaps:176/515 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LDPS--TGKWGRYLDKVLAVAMSLVFMQHNDAELRYLRFEASNRNLDAFLTGMPTYLILVEAQFR 94
            :.||  ||.....:..:.|:..|.:|| ||        |...:..:....:.:....:|::..|.
  Fly     5 MQPSKYTGLVADLMPNIRAMKYSGLFM-HN--------FTGGSAFMKKVYSSVHLVFLLMQFTFI 60

  Fly    95 SLHILLHFEK-----------------LQKFLEI------FY--ANIYIDPRKEPEMFRKVDGK- 133
            .:::.|:.|:                 :.||:.:      ||  .||:......| :|.:.|.: 
  Fly    61 LVNMALNAEEVNELSGNTITTLFFTHCITKFIYLAVNQKNFYRTLNIWNQVNTHP-LFAESDARY 124

  Fly   134 --------------MIINRLVSAMYGAVISLY-----LIA---------------PVFSII--NQ 162
                          :::..:.||.....|:.:     ::.               |:.|..  |.
  Fly   125 HSIALAKMRKLFFLVMLTTVASATAWTTITFFGDSVKMVVDHETNSSIPVEIPRLPIKSFYPWNA 189

  Fly   163 SKDFLYSMIFPFDSDPLYIFVPLLLTNVWVGIVIDTMMFGETNLLCELIVHLNGSYMLLKRDLQL 227
            |....|.:.|.|..  .|:...::.:|     :.|.|........||.:.||.|   ::|..::|
  Fly   190 SHGMFYMISFAFQI--YYVLFSMIHSN-----LCDVMFCSWLIFACEQLQHLKG---IMKPLMEL 244

  Fly   228 AIEKILVARDRPHMAKQLKVLITKTLRKNVALNQ-------------------FGQQLEAQYTVR 273
            :..   :...||:.|...:.|...: :..:..|:                   :|.|..|..|::
  Fly   245 SAS---LDTYRPNSAALFRSLSANS-KSELIHNEEKDPGTDMDMSGIYSSKADWGAQFRAPSTLQ 305

  Fly   274 VF-----------------------------------------------IMFAFAAGLL------ 285
            .|                                               |...:.|.||      
  Fly   306 SFGGNGGGGNGLVNGANPNGLTKKQEMMVRSAIKYWVERHKHVVRLVAAIGDTYGAALLLHMLTS 370

  Fly   286 -CALSFKAYTNPMAN----YIYAI--WFGAKTVELLSLGQIGSDLAFTTDSLSTMYYLTHWEQIL 343
             ..|:..||.....|    |.:.:  :.|....::......|:.|...:.|:....|..||    
  Fly   371 TIKLTLLAYQATKINGVNVYAFTVVGYLGYALAQVFHFCIFGNRLIEESSSVMEAAYSCHW---- 431

  Fly   344 QYSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTSMQ 403
               .:.||..:  ..:.:..:...|...::|.|:|.|||.....:|.|..:||..|..::
  Fly   432 ---YDGSEEAK--TFVQIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYFMVLVQLK 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 71/459 (15%)
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 65/425 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.