DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or35a and Or83a

DIOPT Version :9

Sequence 1:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:336 Identity:69/336 - (20%)
Similarity:123/336 - (36%) Gaps:91/336 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 KMIINRLVSAMYGAVISLYLIAPVFSIINQSKDFLYSMIFPFD-SDP-LYIFVPLL--------- 186
            |:.|...|...|...| .:|..|   |..:.:....:..:||| :.| :|..|.||         
  Fly   147 KLWIKTYVYCCYIGTI-FWLALP---IAYRDRSLPLACWYPFDYTQPGVYEVVFLLQAMGQIQVA 207

  Fly   187 ---LTNVWVGIVIDTMMFGETNLL-CELIVHLNGSYMLLKRDL----QLAIEK-----------I 232
               .::..:.:|:..::.|:.::| |.|...|..||:|:..::    ||..|:           .
  Fly   208 ASFASSSGLHMVLCVLISGQYDVLFCSLKNVLASSYVLMGANMTELNQLQAEQSAADVEPGQYAY 272

  Fly   233 LVARDRPHMAKQLKV----------------------LITKTLRKNVALNQFGQQLEAQYTVRVF 275
            .|..:.| :.:.|||                      .|...|:|          :|:.|:...|
  Fly   273 SVEEETP-LQELLKVGSSMDFSSAFRLSFVRCIQHHRYIVAALKK----------IESFYSPIWF 326

  Fly   276 IMFAFAAGLLCALSFKAYTNPMANYIYAIWFGAKTVELLSLGQIGSDLAFTTDSLSTMYYLTHWE 340
            :.......|:|.::|.:..:..||         ..:.::||||.   |......|..:.|..  :
  Fly   327 VKIGEVTFLMCLVAFVSTKSTAAN---------SFMRMVSLGQY---LLLVLYELFIICYFA--D 377

  Fly   341 QILQYSTNPSENL------RLLKLIN---LAIEMNS-KPFYVTGLKYFRVSLQAGLKILQASFSY 395
            .:.|.|....|.|      |.||.:.   :...:|| :.|.:|..|...:::......:..:||:
  Fly   378 IVFQNSQRCGEALWRSPWQRHLKDVRSDYMFFMLNSRRQFQLTAGKISNLNVDRFRGTITTAFSF 442

  Fly   396 FTFLTSMQRRQ 406
            .|.|..|..|:
  Fly   443 LTLLQKMDARE 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 63/321 (20%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 60/313 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.